PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc003080.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 116aa    MW: 12745.8 Da    PI: 10.6065
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc003080.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM57.93.6e-185810876128
                      NAM  76 ratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                 ++gyWkat  dk+v +   ++ g+kk Lvfy g+ap+g kt+W+mheyrl
  Itr_sc003080.1_g00001.1  58 VHDRTGYWKATKVDKPVGK--PKTLGIKKALVFYVGKAPRGIKTNWIMHEYRL 108
                              23469************98..778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100521.4331116IPR003441NAC domain
SuperFamilySSF1019414.45E-1851110IPR003441NAC domain
PfamPF023651.3E-1056108IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 116 aa     Download sequence    Send to blast
MATVEFKIVS SHSWSYLPVS GSIPPTMSWW CTISAENAPP SLSPFPLSPI GTGSTRTVHD  60
RTGYWKATKV DKPVGKPKTL GIKKALVFYV GKAPRGIKTN WIMHEYRLAN VDRSAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-186210893140Stress-induced transcription factor NAC1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16972469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08790.14e-31NAC family protein